General Information

  • ID:  hor000176
  • Uniprot ID:  O97384
  • Protein name:  Crustacean hyperglycaemic hormone
  • Gene name:  CHH2
  • Organism:  Penaeus monodon (Giant tiger prawn)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  eyestalk, brain, and thoracic ganglia
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HEEYQAHVQTV
  • Length:  11
  • Propeptide:  MTAFRLVAVALVVVVACSTTWARSLEGSSSPVASLIRGRSLSKRANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTVGK
  • Signal peptide:  MTAFRLVAVALVVVVACSTTWA
  • Modification:  T11 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In the control of glucose metabolism
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97384-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000176_AF2.pdbhor000176_ESM.pdb

Physical Information

Mass: 151897 Formula: C58H85N17O20
Absent amino acids: CDFGIKLMNPRSW Common amino acids: EHQV
pI: 5.33 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -110.91 Boman Index: -2684
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.82
Instability Index: 3100.91 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  21459120
  • Title:  Visualization of Neuropeptides in Paraffin-Embedded Tissue Sections of the Central Nervous System in the Decapod Crustacean, Penaeus Monodon, by Imaging Mass Spectrometry